DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG34458

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:258 Identity:72/258 - (27%)
Similarity:113/258 - (43%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLN-LYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGE 209
            :|.|  .|.|..|:||..:::     .|| .:.|||:||:..:::|||||...:.|..:....|.
  Fly    31 RIIG--GQFAAPGQFPHQVSL-----QLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGT 88

  Fly   210 WDTQT---QTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF 271
            .|...   ||       ..:.:.|.|.::|..|...|::::.|.||..:...:||:.|.      
  Fly    89 NDLSAGNGQT-------FNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLA------ 140

  Fly   272 DFDRCYA-------TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET-NLRETRLGRHFILHDSF 328
            |.|..||       :|:|  ...::.:....||...:.:.....|.: |:..        |.|..
  Fly   141 DSDSNYAADTMAMISGFG--AINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG--------LTDRM 195

  Fly   329 ICAGGEKDK-DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            :|||....: .:|:||.|.||.  :.|     |..|:|:||.|||....|.:|..|..||.||
  Fly   196 VCAGHPSGQVSSCQGDSGGPLT--VDG-----KLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/251 (28%)
Tryp_SPc 153..390 CDD:214473 68/249 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 70/256 (27%)
Tryp_SPc 32..254 CDD:238113 72/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.