DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG34290

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:70/265 - (26%)
Similarity:118/265 - (44%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VGFKITGAVNQEAEFGEFPWMLA----ILREEGNLNLYE--CGGALIAPNVVLTAAHCVHNKQPS 201
            ||.:|...|....  .::|:|::    |.|...|...|:  |||:||:...:|:|||||..|...
  Fly    35 VGGRIVSTVGSST--SKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIH 97

  Fly   202 SIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPF--TLQENIQTVCL 264
            .|....|..:.:...:::    .|..|.:.:..|...:..||:|::.::..:  .....:|...|
  Fly    98 YIAAFIGYENIENIGQLQ----PYGLESVEYIYFQPSNFRNDIALLYMKRRYWSDFGNGLQYAQL 158

  Fly   265 PNVGDKFD-FDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH--- 325
            |..|.|.| .:.|...|:|.....  |..|..|.:.::.|:..|:|          |..|.|   
  Fly   159 PPHGMKPDQNESCRIIGYGATHHA--GPCQKRLFEAEVRVIDNQKC----------RDIIGHIWA 211

  Fly   326 ----DSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKL 386
                .:.:||.| .::|:|:||.|.||:|...|:...:   |:|:.|:.||...:|.:|...   
  Fly   212 PQNGANTVCALG-NNQDSCQGDSGGPLICTYGGKDYIY---GLVSHGLTCGIPGMPSIYTVT--- 269

  Fly   387 RPWID 391
            ||:.|
  Fly   270 RPYYD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 65/253 (26%)
Tryp_SPc 153..390 CDD:214473 65/252 (26%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 70/265 (26%)
Tryp_SPc 34..276 CDD:214473 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.