DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG34171

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:255 Identity:64/255 - (25%)
Similarity:103/255 - (40%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGGALIAPNVVLTAAHCVHNK-----QPSSIVVR--AGEWDTQTQTEIRRHEDRYVKEI---IYH 232
            |.|.::....|||:|||:.:|     .|..|||.  |..:.|....|       :|.:|   |.|
  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEE-------FVVDIHNMIIH 114

  Fly   233 EQFNKGSLYNDVAVMLLESPFTLQ-ENIQTVCLPN----VGDKFDFDRCYATG--WG--KNKFGK 288
            ..:::.. :||:|::.|:....|. .::..|.|.|    ||:.     |...|  :|  :.:|| 
  Fly   115 PYYHRNQ-HNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGND-----CKTIGGIFGVRRQRFG- 172

  Fly   289 DGEYQVILKKVDMPVVPEQQC---ETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVC 350
             ..:.::|..|::.  |..:|   :.:|...|..     ::..||. ...:|..|..|.|.||.|
  Fly   173 -SFHSMLLVNVELR--PFDECLKVKKSLMAARPE-----NEDLICV-KSTEKQMCTTDFGGPLFC 228

  Fly   351 PIAGQKNRFKSAGIVAWGIGCGEVNI----PGVYASVAKLRPWIDAKLKIWSIDPRHYTP 406
            .  ||          .:||..|.:|.    |..::.|:....|:   .||.|....|..|
  Fly   229 D--GQ----------LYGIALGSINCSSPDPVFFSDVSFYNSWV---TKIISEAVDHTRP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 59/238 (25%)
Tryp_SPc 153..390 CDD:214473 58/237 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/237 (24%)
Tryp_SPc 38..263 CDD:304450 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.