DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:96 Identity:33/96 - (34%)
Similarity:52/96 - (54%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRF 359
            |::..:|||....|...|..|       :.|:.:||| .:..||||:||.|.|:|   :.|.:.:
Zfish    16 LQQTVVPVVINSDCNNLLGAT-------ITDNMMCAGLLQGGKDTCQGDSGGPMV---SQQCSVW 70

  Fly   360 KSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            ..:||::.|..||:...||||..|::.:.||
Zfish    71 VQSGIISKGHDCGQPYEPGVYTRVSQYQNWI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 33/96 (34%)
Tryp_SPc 153..390 CDD:214473 31/94 (33%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.