DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:188 Identity:55/188 - (29%)
Similarity:82/188 - (43%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 DRYVKE--IIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDR-CYATGWGKN 284
            ::|.|.  :|.|..:|:.:...|:.::.|.:|..|...:....||.........| |..:|||..
Zfish    20 EQYSKPLMLIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMCRVSGWGST 84

  Fly   285 KFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEK-DKDTCK------- 341
            .. ..|...:.|:.|.:|:|...:|  |...:..|.   :..:.||||... .||.||       
Zfish    85 SH-SGGLIPLTLRTVRLPIVSTFKC--NSSSSFSGN---ITANMICAGSSTGGKDACKNSTQYLC 143

  Fly   342 --------GDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
                    ||.|.||||.       .:..|:|:||.|||:...||||.:|::.|.|||
Zfish   144 HLIVYLCQGDSGGPLVCD-------GRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWID 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 53/186 (28%)
Tryp_SPc 153..390 CDD:214473 52/185 (28%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 55/188 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.