DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and PRSS2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:258 Identity:72/258 - (27%)
Similarity:121/258 - (46%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHC----VHNK------QP 200
            ||.|  ....|....|:.:::     |...:.|||:||:...|::|.||    :::|      :.
Human    23 KIVG--GYICEENSVPYQVSL-----NSGYHFCGGSLISEQWVVSAGHCYKSAINSKLSGRGCEY 80

  Fly   201 SSIVVRAGEWDTQTQTEIRRHEDRYVK--EIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVC 263
            ..|.||.||.:    .|:....::::.  :||.|.::|..:|.||:.::.|.||..:...:..:.
Human    81 HRIQVRLGEHN----IEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAIS 141

  Fly   264 LPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSF 328
            ||........: ...:||| |......:|...|:.:|.||:.:.:||.:..    |:   :.::.
Human   142 LPTAPPAAGTE-SLISGWG-NTLSSGADYPDELQCLDAPVLSQAECEASYP----GK---ITNNM 197

  Fly   329 ICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            .|.|. |..||:|:||.|.|:|       :..:..|||:||.||.:.|.||||..|.....||
Human   198 FCVGFLEGGKDSCQGDSGGPVV-------SNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/251 (27%)
Tryp_SPc 153..390 CDD:214473 67/249 (27%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 70/256 (27%)
Tryp_SPc 24..256 CDD:238113 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.