DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and masp2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001116330.1 Gene:masp2 / 560277 ZFINID:ZDB-GENE-060130-154 Length:684 Species:Danio rerio


Alignment Length:259 Identity:76/259 - (29%)
Similarity:123/259 - (47%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGA-LIAPNVVLTAAHCVHNKQPS-SIVVRAG 208
            |:.|..|  ||..|.||.:.|     .:.....||| |::...||||||.|.:.:.| ::.:|.|
Zfish   435 KVIGGEN--AEKNEIPWQVMI-----RMGTKFIGGASLLSDGWVLTAAHVVKSFEDSANLQLRMG 492

  Fly   209 EWDTQTQTEIRRHEDRYV----KEIIYHEQFNKGSL-YN-DVAVMLLESPFTLQENIQTVCLPNV 267
                    .::.|::..|    ::|..|.|::..:: :| |:|::.||....:.:.:..||||..
Zfish   493 --------TVKHHDNEAVVGIPQKIFIHPQYHHDNVNFNHDIALIKLEYKVPVSKAVMPVCLPGR 549

  Fly   268 GDKFDF---DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGR-HFILHDSF 328
            .::|..   |....:|||.:.......:...||.|.:||.....|:|....|...: ..::.::.
Zfish   550 EERFVLKANDVGKVSGWGVSNINTPALFSGNLKYVHLPVSNFNDCKTKYDSTVTSKGKLVVTENM 614

  Fly   329 ICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
            |||| .:..||:|:||.|.|........|:.| ..|||:||.||.:....|||..|:....||:
Zfish   615 ICAGFSQGGKDSCQGDSGGPFAFFDKQSKSWF-IGGIVSWGHGCAQAGYYGVYTKVSNYLSWIE 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/250 (29%)
Tryp_SPc 153..390 CDD:214473 71/249 (29%)
masp2NP_001116330.1 CUB 24..130 CDD:214483
EGF_CA 134..176 CDD:214542
CUB 180..289 CDD:278839
CCP 296..357 CDD:214478
CCP 362..410 CDD:153056
Tryp_SPc 435..676 CDD:214473 74/256 (29%)
Tryp_SPc 436..679 CDD:238113 75/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.