DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and KLK15

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:254 Identity:74/254 - (29%)
Similarity:114/254 - (44%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHED-- 223
            ||.:| |.|.|..|   ||.:||:|:.||:||||    |...:.||.||.:      :|:.:.  
Human    34 PWQVA-LYERGRFN---CGASLISPHWVLSAAHC----QSRFMRVRLGEHN------LRKRDGPE 84

  Fly   224 --RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL----PNVGDKFDFDRCYATGWG 282
              |....:|.|.::...|..||:.::.|..|..|...::...|    |:.|     :.|..:|||
Human    85 QLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPG-----EACVVSGWG 144

  Fly   283 KNKFGKDGEYQVILKKVDMP---------VVPEQQCETNLRETRLGRHFILHDSFICAGGE-KDK 337
            .....:.|.......:|.:|         ::.:..|:    ::..||   |.::.:|||.| :..
Human   145 LVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCD----KSYPGR---LTNTMVCAGAEGRGA 202

  Fly   338 DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWIDAKLK 395
            ::|:||.|.||||....|       |||:|| :.|.....||||..|.....||...:|
Human   203 ESCEGDSGGPLVCGGILQ-------GIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/248 (29%)
Tryp_SPc 153..390 CDD:214473 71/247 (29%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.