DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:297 Identity:87/297 - (29%)
Similarity:142/297 - (47%) Gaps:53/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILR 168
            |.|:  ||:|...|                   ..|.||         ..:|..|.:||..:|.|
Zfish    20 ALCQ--LDVCGQAP-------------------LNNNNG---------GDDAVAGSWPWQASIHR 54

  Fly   169 --EEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHE-DRYVKEII 230
              .|.::    |||:||..:.||:||||......::|.:..|.   |.||....:| .|.:.:|:
Zfish    55 ISPEDHI----CGGSLINKDWVLSAAHCFMITATANIKIFLGR---QFQTGSNPNEISRTLTQIV 112

  Fly   231 YHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-DFDRCYATGWGKNKFGKDGEYQV 294
            .|..::..:..||:|::.|.|..|..:.|:.|||.:....| ...:.:.|||.|:: ..|.:...
Zfish   113 IHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSWITGWDKHR-SSDIQVTN 176

  Fly   295 ILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNR 358
            :|::|.:|||...:|..:.:.       |:.|:.|||| .|..||.|:||.|.|:|   :...:|
Zfish   177 VLQEVQLPVVSNTECNADYKG-------IITDNMICAGINEGGKDACQGDSGGPMV---SQNGSR 231

  Fly   359 FKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLK 395
            :..:|||::|..||....||:|..|::.:.||.::|:
Zfish   232 WIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/242 (31%)
Tryp_SPc 153..390 CDD:214473 75/241 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 76/252 (30%)
Tryp_SPc 37..263 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.