DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and cfd

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001018368.1 Gene:cfd / 553553 ZFINID:ZDB-GENE-050522-411 Length:249 Species:Danio rerio


Alignment Length:261 Identity:73/261 - (27%)
Similarity:112/261 - (42%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWD 211
            |||  .|||:....|:|.::   :.| ..:||||.||:...|::||||..:.:.|.:.|..|...
Zfish    21 ITG--GQEAKAHSRPYMASV---QWN-GKHECGGFLISSQWVMSAAHCFQDGRTSGVKVVLGAHS 79

  Fly   212 TQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDR- 275
            .....:.::..|   .|:..|..|:..:..||:|::.|:.|.|..:.::.|       ||..|. 
Zfish    80 LSGAEDTKQTFD---AEVYNHPDFSISNYDNDIALIKLDKPVTQSDAVKPV-------KFQRDET 134

  Fly   276 --------CYATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFIC 330
                    ....|||  .|..|:..:    |.::.:||:...:|.   |....|..|.  .:.:|
Zfish   135 ADPKEAAVVETAGWGSLNNMGGRPDK----LHELSIPVMERWRCG---RADFYGEKFT--SNMLC 190

  Fly   331 AGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVA-----WGIGCGEVNIPGVYASVAKLRPWI 390
            | .:|.||||.||.|.||:           ..|||.     .|..||....||:|..::....||
Zfish   191 A-ADKRKDTCDGDSGGPLL-----------YRGIVVGITSNGGKKCGSSRKPGLYTIISHYASWI 243

  Fly   391 D 391
            |
Zfish   244 D 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 68/253 (27%)
Tryp_SPc 153..390 CDD:214473 67/252 (27%)
cfdNP_001018368.1 Tryp_SPc 21..246 CDD:238113 73/261 (28%)
Tryp_SPc 21..243 CDD:214473 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.