DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and cela1.1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:257 Identity:78/257 - (30%)
Similarity:118/257 - (45%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 AVNQEAEFGE------FPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAG 208
            |:.:....||      :||.:::..:.|....:.|||.||.|..|:.|||||...:..|:.:  |
Zfish    25 AIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLIRPGWVMVAAHCVDTSRIWSVAL--G 87

  Fly   209 EWDTQTQTEIRRHE--DRY--VKEIIYHEQFNKGSLY--NDVAVMLLESPFTLQENIQTVCLPNV 267
            :.||.|      ||  ::|  ||.:..|..:|...:.  ||:|::.|....||...:|...||:.
Zfish    88 DHDTTT------HEGPEQYISVKGVFIHPNWNPNIVANGNDIALLQLSINATLSSYVQVATLPSY 146

  Fly   268 GDKFDFDR-CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICA 331
            |:...:.. ||.||||:.:.|  |.....||:..||||..:.|.   :....|.  .:.|..|||
Zfish   147 GEILPYGHTCYITGWGRTQTG--GSLSAQLKQAYMPVVDHETCS---QSDWWGS--TVKDRMICA 204

  Fly   332 GGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAW--GIGCGEVNIPGVYASVAKLRPWID 391
            ||......|.||.||||.|...|:   :...|:.::  ..||.....|.|:..|:....|::
Zfish   205 GGTTSMSACHGDSGSPLNCLFNGE---YVVHGVTSFVASSGCNTYKKPTVFTRVSYHVSWLN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 77/252 (31%)
Tryp_SPc 153..390 CDD:214473 76/251 (30%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 76/249 (31%)
Tryp_SPc 30..265 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.