DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and f10

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:353 Identity:99/353 - (28%)
Similarity:156/353 - (44%) Gaps:52/353 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SSGSTGSENGGSS-STQYQSCGD---QKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDL 112
            ::|....|||.|. .|:..|||.   ::|.....|..||..|           .||::.:..::.
 Frog   151 TNGYILGENGKSCLPTEKYSCGRRHMKRERRETKLHENDKKN-----------HTDSQNEVKMNQ 204

  Fly   113 CCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYE 177
            ...||.:           :..|....|||....:|.|  .:|...||.||...::.:|..   ..
 Frog   205 TGTLPER-----------NVTGINILNPNDPNVRIVG--GRECSQGECPWQALLVSDEDE---GF 253

  Fly   178 CGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQ--TEIRRHEDRYVKEIIYHEQFNKGSL 240
            |||.:::...:||||||::..:...:||  ||.:|:..  || ..|:   |::||.|.:|.|.:.
 Frog   254 CGGTILSREFILTAAHCMNQTKYFKVVV--GELNTKISEGTE-SIHK---VEKIIMHPRFVKSTY 312

  Fly   241 YNDVAVMLLESPFTLQENIQTVCLPN--VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPV 303
            ..|:||:.|:......|||...|:|:  ..|:...:...|...|..:..:.|.....|:.:.:|.
 Frog   313 DYDIAVIKLKEAINFTENIIPACIPDPEFADQVLMNEPDAMVSGFGRIHERGRQASTLQMLQVPY 377

  Fly   304 VPEQQCETNLRETRLGRHFILHDSFICAGGEKD-KDTCKGDGGSPLVCPIAGQKNRFKSAGIVAW 367
            :....|:.:       ..|.:.::..|||.:.: ||.|:||.|.|.|.|.   |..:...|||:|
 Frog   378 IKRHSCKES-------STFAITENMFCAGFDTEVKDACQGDSGGPHVTPF---KGTYFVTGIVSW 432

  Fly   368 GIGCGEVNIPGVYASVAKLRPWIDAKLK 395
            |.||......|||..|:||..|:...||
 Frog   433 GEGCARKGKFGVYTKVSKLHRWLKGVLK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/242 (30%)
Tryp_SPc 153..390 CDD:214473 72/241 (30%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209 4/11 (36%)
Tryp_SPc 228..456 CDD:238113 75/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.