DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tpsab1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:248 Identity:82/248 - (33%)
Similarity:124/248 - (50%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCV--HNKQPSSIVVRAGEWDTQTQ 215
            |||...::||.:: ||......::.|||:||.|..||||||||  :...|:.:.|       |.:
  Rat    70 QEASGNKWPWQVS-LRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRV-------QLR 126

  Fly   216 TEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDR-CY 277
            .:...:.|..  |.:||.|..|.......|:|::.|.:|..:..|:.||.||...:.|.... |:
  Rat   127 KQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCW 191

  Fly   278 ATGWG--KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRE---TRLGRHFILHDSFICAGGEKDK 337
            .||||  .|.......:.  |::|.:|:|..:.|:....:   |....| |:.|..:|||.| ..
  Rat   192 VTGWGNINNDVSLPPPFP--LEEVQVPIVENRLCDLKYHKGLNTGDNVH-IVRDDMLCAGNE-GH 252

  Fly   338 DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            |:|:||.|.||||.:   ::.:..||:|:||.||.:.|.||:|..|.....||
  Rat   253 DSCQGDSGGPLVCKV---EDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/248 (33%)
Tryp_SPc 153..390 CDD:214473 80/246 (33%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 80/246 (33%)
Tryp_SPc 66..302 CDD:238113 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346324
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.