DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and prss60.2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:268 Identity:95/268 - (35%)
Similarity:139/268 - (51%) Gaps:32/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAIL--REEGNLNLYECGGALIAPNVVLTAAHCVHN 197
            || |.|  :..:|.|.||  |..|.:||.:::.  |..|:.    |||:||:...|||||||:..
Zfish    25 CG-QAP--LNSRIVGGVN--APEGSWPWQVSLQSPRYGGHF----CGGSLISSEWVLTAAHCLPG 80

  Fly   198 KQPSSIVVRAGEWDTQTQTEIRRHE-DRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            ...||:||..|.   :||..:..|| .|.|.:||.|..:|..:..||:|::.|.|..|..:.|:.
Zfish    81 VSESSLVVYLGR---RTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRP 142

  Fly   262 VCLPNVGDKFDF-DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH 325
            |||......:.. ...:.||||..:.|.:.....||::..:|||...:|     ..:||...:. 
Zfish   143 VCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC-----NAQLGSGTVT- 201

  Fly   326 DSFICAGGEK-DKDTCKGDGGSPLV---CPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKL 386
            ::.||||..| .||||:||.|.|:|   |.:      :..|||.:||.||.:.|.||||..|::.
Zfish   202 NNMICAGLAKGGKDTCQGDSGGPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRVSQY 260

  Fly   387 RPWIDAKL 394
            :.||.:|:
Zfish   261 QSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 85/245 (35%)
Tryp_SPc 153..390 CDD:214473 84/244 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 88/251 (35%)
Tryp_SPc 34..267 CDD:238113 90/253 (36%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.