DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss44

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:378 Identity:101/378 - (26%)
Similarity:160/378 - (42%) Gaps:87/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSSPPPPVVNPKDSSGSTGSE-------------NGGSSSTQYQSCGDQKECVPRWLCANDTINT 90
            ||..|.|..|..|..|....|             ..|.|.|.:.|.|                .|
  Rat    33 PSLSPLPSENGLDDPGVNPQERPLTGMPETSLPLKPGGSMTPFDSMG----------------FT 81

  Fly    91 SGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHP--EGCGYQNPNGVGFKITGAVNQ 153
            .|.....:.|...:                      |.|..|  ..||::....||.|       
  Rat    82 PGHSFSSMSLSRQS----------------------FPPWIPPTSACGHRTARIVGGK------- 117

  Fly   154 EAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEI 218
            .|...::||.:::...:.::    |||:||:...|:||||||:..  ...||..||.|..:...:
  Rat   118 PAPIRKWPWQVSLQVHKQHI----CGGSLISKWWVMTAAHCVYGH--LDYVVSMGEADLWSSMSV 176

  Fly   219 RRHEDRYVKEIIYHEQFN-KGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDF-----DRCY 277
            :..    |::||.|:.:: ..::.:|:|::||..|.....|||.||:|    :..|     ..|:
  Rat   177 KIP----VQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIP----EKSFLVQPGTLCW 233

  Fly   278 ATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF-ILHDSFICAGGEKDKDTCK 341
            .|||||..  :.|....:|::||:.::..::|...|::. .||.| ::.:..:|...:|..|.|:
  Rat   234 VTGWGKTI--ERGRSSRVLREVDLSIIRHERCNQILKDI-TGRIFTLVQEGGVCGYNKKGGDACQ 295

  Fly   342 GDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            ||.|.|:||..   ...:...|||:||:|||.:..||:|..|:..|.||..:|
  Rat   296 GDSGGPMVCEF---NKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKEL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/244 (31%)
Tryp_SPc 153..390 CDD:214473 74/243 (30%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 77/255 (30%)
Tryp_SPc 113..341 CDD:238113 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4145
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.