DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss33

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:272 Identity:88/272 - (32%)
Similarity:133/272 - (48%) Gaps:29/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK- 198
            ||...   :..:|.|  .::|:.||:||..:|.....::    |||:||||..||||.||...: 
  Rat    25 CGQPR---MSSRIVG--GRDAQDGEWPWQTSIQHRGAHV----CGGSLIAPQWVLTAGHCFSRRV 80

  Fly   199 QPS--SIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261
            .||  |:::.|...|..:..|:...    |..::....:::.....|:|::.|..|.:|...||.
  Rat    81 LPSEYSVLLGALSLDVTSSHELLVP----VLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQP 141

  Fly   262 VCLPNVGD-KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF--- 322
            ||||..|. ......|:.||||....|........|:.|.:|::..:.|:   |...:|.:.   
  Rat   142 VCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACD---RLYHMGANVPKS 203

  Fly   323 --ILHDSFICAGGEK-DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVA 384
              |:....:|||..: .||.|:||.|.||.|..:|   |:...|:|:||.||...|.||||.:||
  Rat   204 ERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESG---RWVLVGVVSWGKGCALPNRPGVYTNVA 265

  Fly   385 KLRPWIDAKLKI 396
            |..|||.|:|.:
  Rat   266 KYSPWIQARLSL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/247 (33%)
Tryp_SPc 153..390 CDD:214473 80/246 (33%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 82/253 (32%)
Tryp_SPc 34..272 CDD:238113 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.