DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Prss36

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:272 Identity:87/272 - (31%)
Similarity:130/272 - (47%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHC-VHNK 198
            ||...|:.   :|.|  ..:|..|.:||.:::....|::    |||:||||:.||:|||| |.| 
  Rat    50 CGRPEPSS---RIVG--GSDAHPGTWPWQVSLHHGGGHI----CGGSLIAPSWVLSAAHCFVTN- 104

  Fly   199 QPSSIVVRAGEWDT-----QTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258
               ..:..|.||..     .....:.....|.|..|:..:.:::..|..|:|::.|.||..|..:
  Rat   105 ---GTLEPADEWSVLLGVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPS 166

  Fly   259 IQTVCLPNVGDKFDF-DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCET--------NLR 314
            ::.||||.....|.. ..|:|||||..:.........:|::|::.::.|..|:.        ||.
  Rat   167 VKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLT 231

  Fly   315 ETRLGRHFILHDSFICAG-GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPG 378
                   ..|....:||| .|..:|||:||.|.||||...|   |:..|||.::|.|||..|.||
  Rat   232 -------LQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGG---RWFLAGITSFGFGCGRRNRPG 286

  Fly   379 VYASVAKLRPWI 390
            |:.:||....||
  Rat   287 VFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/254 (32%)
Tryp_SPc 153..390 CDD:214473 80/252 (32%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 84/260 (32%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.