DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and cela1.2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:247 Identity:68/247 - (27%)
Similarity:117/247 - (47%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEI 218
            |.:...:||.:::....|....:.|||:||..|.||||||||.......:||  |:.:.......
 Frog    34 EVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRANRVLTAAHCVDRAVSYRVVV--GDHNIYQNDGT 96

  Fly   219 RRHEDRYVKEIIYHEQFNKGSL---YNDVAVMLLESPFTLQENIQTVCLP--NVGDKFDFDRCYA 278
            .::..  |..|:.|..:|..::   | |::::.|.|..||...::...||  ||....::: |..
 Frog    97 EQYIS--VSRIVKHANWNPNNIAAGY-DISILHLSSSATLNSYVKLAQLPADNVVLAHNYN-CVV 157

  Fly   279 TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF--ILHDSFICAGGEKDKDTCK 341
            |||||.  ..:|....:|::..:||:....|.:       |.::  .:..:.:||||:..:..|:
 Frog   158 TGWGKT--SNNGNLASVLQQAPLPVIAHSTCSS-------GSYWGSTVKSTMVCAGGDGVRSGCQ 213

  Fly   342 GDGGSPLVCPIAGQKNRFKSAGIVAW--GIGCGEVNIPGVYASVAKLRPWID 391
            ||.|.||.||:.|.   ::..|:.::  ..||.....|.|:..|:....||:
 Frog   214 GDSGGPLNCPVNGV---YQVHGVTSFVSSSGCSTYLKPTVFTRVSAYIGWIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 67/245 (27%)
Tryp_SPc 153..390 CDD:214473 66/244 (27%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.