DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and masp2

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001011037.1 Gene:masp2 / 496446 XenbaseID:XB-GENE-1007491 Length:687 Species:Xenopus tropicalis


Alignment Length:411 Identity:116/411 - (28%)
Similarity:172/411 - (41%) Gaps:73/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILLNCLVICLCIFSC---GAQDSSLDKLISDIFKTDETPKPSSPPPPVV---NPKDSSGSTGSE 59
            ::|.|...|.....:|   |..|..|.|.|                  :|   ||.|....|.|.
 Frog   332 VLLENARTIPSFTMTCLPDGTWDKKLPKCI------------------IVNCGNPDDIENGTYSF 378

  Fly    60 NGGSSSTQYQSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPI 124
            ......|.|.|       |.::.|........|.|  :.|.|.|...:       |:.:::|.| 
 Frog   379 VTAKEVTLYNS-------VVQYNCTEPYYIKEGKG--EYRCGADGFWE-------DIESEKKTP- 426

  Fly   125 FEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVL 189
                |.....||.:.|...| :|.|  .:.|..|||||.:.|     |.|....||||:..|.:|
 Frog   427 ----PICVPDCGKRKPAAAG-RIVG--GEFANVGEFPWQVFI-----NANNERGGGALLLDNWIL 479

  Fly   190 TAAHCVHNKQP-SSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPF 253
            ||||.|::... |||:::.|...||....||    .:.:.:..||.:..|...||:|::.|::..
 Frog   480 TAAHVVYSYDDLSSILIKMGFLSTQDSNYIR----GWPEAVFIHEGYKPGHYNNDIALIKLKNKV 540

  Fly   254 TL-QENIQTVCLP------NVGDKFDFDRC-YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE 310
            .| :|:|..:|||      ::..|.|.:.. ...|||..:..:....   |:.|::.:|....|:
 Frog   541 PLSEESILGICLPTKEKSYHISHKDDDNHVGLVAGWGLTEAQRSSRK---LRFVEVNIVDHSTCK 602

  Fly   311 TNLRETRLGRHFILHDSFICAGGEKD-KDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEV 374
            ...  .:|...:|:.::.||||.|.. ||:|.||.|..|....|..|..| ..|||:||:|||..
 Frog   603 AEY--AKLDAQYIVTENMICAGFEIGVKDSCAGDSGGALAFMNAESKKWF-VGGIVSWGVGCGVA 664

  Fly   375 NIPGVYASVAKLRPWIDAKLK 395
            ...|||..|.....||:..::
 Frog   665 RQYGVYTKVTNYLDWIEKTIQ 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 80/247 (32%)
Tryp_SPc 153..390 CDD:214473 79/246 (32%)
masp2NP_001011037.1 CUB 30..139 CDD:238001
FXa_inhibition 145..180 CDD:317114
CUB 184..294 CDD:238001
CCP 299..361 CDD:153056 8/28 (29%)
CCP 365..430 CDD:153056 19/85 (22%)
Tryp_SPc 443..680 CDD:214473 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.