DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and sdhaf4

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis


Alignment Length:52 Identity:13/52 - (25%)
Similarity:19/52 - (36%) Gaps:7/52 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DIFKTDETPKPSSPPPPVVNP--KDSSGSTGSENGGSSSTQYQSCGDQKECV 78
            |..:|.....|....|..:||  |:..|..|.|     .|:|.....:..|:
 Frog    70 DSEQTTLEKNPLEKFPDDINPVTKEKGGPRGPE-----PTRYGDWERKGRCI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113
Tryp_SPc 153..390 CDD:214473
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.