DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:242 Identity:75/242 - (30%)
Similarity:106/242 - (43%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 AEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIR 219
            |..|:||:.:.:: .:|:|   .|||:||:...|||||||  ....|...||||.....:...:|
Mosquito    50 ASLGQFPYQVFLI-GDGSL---ACGGSLISAEWVLTAAHC--QVGISQFTVRAGSIQNNSGGTVR 108

  Fly   220 RHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP--NVGDKFDFDRCYATGWG 282
            ..     ..||.|..:|..:|.||:.::.|..|..|..|||.|.||  |:.:.|.......:|:|
Mosquito   109 TS-----NLIIIHPNYNPSNLNNDIGLIRLNEPMPLGGNIQVVALPEANLSETFLNREATVSGFG 168

  Fly   283 KNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRH--FILHDSFICAGGE--KDKDTCKGD 343
            :.. ...|.....|..|.:.::...||        :|.:  ..:.||.:||.|.  .::.||.||
Mosquito   169 RTS-DASGAISPNLNFVHLNIISNIQC--------MGTYGSATIIDSTVCAVGRDAPNQGTCNGD 224

  Fly   344 GGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            .|.||.....||..:......|| ..|| ||..|..|......|.||
Mosquito   225 SGGPLTVTENGQSVQIGVVSFVA-AAGC-EVGFPSGYVRTTHFRNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/242 (31%)
Tryp_SPc 153..390 CDD:214473 73/240 (30%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 73/240 (30%)
Tryp_SPc 44..272 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.