DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP005587

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_001237684.2 Gene:AgaP_AGAP005587 / 4576204 VectorBaseID:AGAP005587 Length:296 Species:Anopheles gambiae


Alignment Length:291 Identity:65/291 - (22%)
Similarity:108/291 - (37%) Gaps:85/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QNPNGVG---FKITGAVNQ------EAEFGEFPW-MLAILREEG----NLNLYECGGALIAPNVV 188
            :.||.|.   .:|....|:      |...|:||: .|..:..|.    ..::.:..|:||.||.:
Mosquito    43 RRPNVVDTNQVRIVSETNRLSSDGYEIYAGQFPYHALVYINNENPKPWESSIVQTAGSLITPNYI 107

  Fly   189 LTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEII--------YHEQFNKGSLYNDVA 245
            ||:|..:...     ::..|:.....:...|...||..:::|        .|.:|:.|..|| :|
Mosquito   108 LTSAEVLRKN-----ILGNGKTYGFVELGYRNGADRERQQVIDFTNSSISIHPRFSGGLFYN-IA 166

  Fly   246 VMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE 310
            .:.||.|.||...:|.:.||.:.|...|:....|..|.:       |...::.:...|:|...| 
Mosquito   167 TIRLEHPATLNRYVQPIRLPRLSDNRTFEMMEGTSLGHH-------YNGTMRYMRNQVLPHDNC- 223

  Fly   311 TNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGI----------- 364
                   |.:.::..:|||              ||:  .|      ||...||:           
Mosquito   224 -------LLQEYVCTNSFI--------------GGA--FC------NRVDGAGLTVEDEDGPILI 259

  Fly   365 -----VAWGIGCGEVNIPGVYASVAKLRPWI 390
                 |.|   | ::|...:...|:..|.||
Mosquito   260 GFTMRVYW---C-DLNERDINTRVSVYRDWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 60/273 (22%)
Tryp_SPc 153..390 CDD:214473 58/271 (21%)
AgaP_AGAP005587XP_001237684.2 Tryp_SPc 54..286 CDD:214473 60/278 (22%)
Tryp_SPc 66..289 CDD:304450 60/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.