DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP000411

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_001237291.3 Gene:AgaP_AGAP000411 / 4576124 VectorBaseID:AGAP000411 Length:1091 Species:Anopheles gambiae


Alignment Length:279 Identity:72/279 - (25%)
Similarity:117/279 - (41%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DHPEGCGYQNPNGVGFKITGAVNQEAE--FGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAA 192
            || ..||.:.     .|.|..::..|:  .|.:||..||..::.....|.|||:::....:|||:
Mosquito     8 DH-LSCGRRK-----VKTTYLIHNGADAIAGHWPWHAAIFHQKDKHKEYACGGSILDETTILTAS 66

  Fly   193 HCVHNK----QPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPF 253
            |||...    ..:.:.|..|:......:|..:..:  .:|||.:..|:|.|:.:|:|::.|.:..
Mosquito    67 HCVSTLSGVISAALVTVHVGQIHLNQSSEYTQTFE--AREIIINPGFSKASIIHDIALIKLRTNI 129

  Fly   254 TLQENIQTVCLPNVGDKFDFDRCYATGWGKN----KFGKDGEYQVI---LKKVDMPVVPEQQCET 311
            ::...:|.|||      :..|.......|:|    .||. .|..|:   ||:..:.||....|..
Mosquito   130 SMNRYVQPVCL------WTMDSALELIVGRNGTIVGFGL-SERDVVSEQLKQATIGVVDPYTCIA 187

  Fly   312 NLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNI 376
            :.|.. .|.|..|  ...|..|:.....|.||.|..:...::|   |:...|:|::....|...:
Mosquito   188 SDRVV-YGTHLTL--EMFCGKGQNGVSACNGDSGGGMFFEVSG---RWFVRGLVSFTPARGSSGL 246

  Fly   377 PG-----VYASVAKLRPWI 390
            ..     ||..|||...||
Mosquito   247 CDPLKYTVYTDVAKYVEWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 66/256 (26%)
Tryp_SPc 153..390 CDD:214473 64/254 (25%)
AgaP_AGAP000411XP_001237291.3 Tryp_SPc 23..267 CDD:238113 66/258 (26%)
Tryp_SPc 25..265 CDD:214473 64/254 (25%)
Tryp_SPc 308..>462 CDD:304450
Trypsin 838..1069 CDD:278516
Tryp_SPc 864..>946 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.