DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and AgaP_AGAP012566

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_001230550.2 Gene:AgaP_AGAP012566 / 4397709 VectorBaseID:AGAP012566 Length:282 Species:Anopheles gambiae


Alignment Length:226 Identity:56/226 - (24%)
Similarity:84/226 - (37%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ILREEGNLNLYECGGALIAPNVVLTAAHCVH--------------NKQPSSIVVRAGEWDTQTQT 216
            |||.:|.:   .|...:|:.:..||.|..|:              :..|:|     |.:..|   
Mosquito    67 ILRLDGQI---RCSAVVISLSHALTGADAVYPYRNNIQRLTLYGGSTSPTS-----GGFSFQ--- 120

  Fly   217 EIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESP---FTLQENIQTVCLPNVGDKFDFDRCYA 278
                     :..|..|..||..|..:|..:.:|..|   |..:.||..:.|.:.|.... .:|..
Mosquito   121 ---------LTRIAVHPNFNPNSGVSDFNIAVLTVPTNSFGGKRNIAPISLASAGVAIG-TKCSV 175

  Fly   279 TGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF--ILHDSFICAGGEKDKDTCK 341
            .||||......|.... |:..||.:..|..|      .||...|  .:..:.:||.|::..|.|.
Mosquito   176 FGWGKTSVNLSGPANT-LRSADMIITSEATC------ARLWAQFGVKITSNMVCAKGDRGADLCT 233

  Fly   342 GDGGSPLVCPIAGQKNRFKSAGIVAWGIGCG 372
            ||.|:.|||  :|     :..|:......||
Mosquito   234 GDYGNALVC--SG-----RLTGVAILSNTCG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 56/226 (25%)
Tryp_SPc 153..390 CDD:214473 56/226 (25%)
AgaP_AGAP012566XP_001230550.2 Tryp_SPc 50..276 CDD:214473 56/226 (25%)
Tryp_SPc 51..279 CDD:304450 56/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.