DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:113/261 - (43%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQ--EAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAG 208
            ||.|.:..  .|..|:.|:::.:| ..||.|.: |||::|....|||||||.:.  .|.:.:..|
  Fly    33 KIQGRITNGYPAYEGKVPYIVGLL-FSGNGNWW-CGGSIIGNTWVLTAAHCTNG--ASGVTINYG 93

  Fly   209 EWDTQTQTEIRRHEDRYVK-----EIIYHEQFNKGSLYNDVAVMLLESPFT-LQENIQTVCLPNV 267
                    ...|::.:|..     ..:.|..:|.|:|:||::  |:.:|.. ....:..|.||:.
  Fly    94 --------ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDIS--LIRTPHVDFWHLVNKVELPSY 148

  Fly   268 GDKF-DFDRCY--ATGWGKNKFGKDGEYQVI-----LKKVDMPVVPEQQCETNLRETRLGRHFIL 324
            .|:: |:...:  |:|||       |.|...     |:.||:.::.:..|         .|.:.|
  Fly   149 NDRYQDYAGWWAVASGWG-------GTYDGSPLPDWLQAVDVQIMSQSDC---------SRTWSL 197

  Fly   325 HDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPW 389
            ||:.||......|.||.||.|.|||   ..:.||...........|| :...|.|::.|.....|
  Fly   198 HDNMICINTNGGKSTCGGDSGGPLV---THEGNRLVGVTSFVSSAGC-QSGAPAVFSRVTGYLDW 258

  Fly   390 I 390
            |
  Fly   259 I 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/254 (27%)
Tryp_SPc 153..390 CDD:214473 67/252 (27%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 67/255 (26%)
Tryp_SPc 38..262 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
11.000

Return to query results.
Submit another query.