DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG9733

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:292 Identity:87/292 - (29%)
Similarity:132/292 - (45%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEGCGYQNPNGVGFKITGAVNQEAEFGEFPWM--LAILREEGNLNLYECGGALIAPNVVLTAAHC 194
            |..||     |||.:......|:.:..|||||  |...|..||.....|.|:||....|||||||
  Fly   150 PPSCG-----GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHC 209

  Fly   195 ----VHNKQPSSIVVRAGEWDTQT-----------QTEIRRHEDRYVKEIIYHEQFNK--GSLYN 242
                :..:..:.:.||.||.||:|           ..|::|   ...:||..||::::  .:..:
  Fly   210 LTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQR---LGFEEIRVHERYSEKASNQVH 271

  Fly   243 DVAVMLLESPFTLQENIQTVCLPN--------VGDKFDFDRCYATGWGKN-KFGKDGEYQVILKK 298
            |:.::.:|......:|||.:|||:        .|.:|.     ..|||:. |..:    ..:.:|
  Fly   272 DIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFT-----VAGWGRTLKMAR----SAVKQK 327

  Fly   299 VDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKS-- 361
            |.:..|...:|.....:.::.    |..:.:||||:..||:|.||.|.||:        ||:.  
  Fly   328 VTVNYVDPAKCRQRFSQIKVN----LEPTQLCAGGQFRKDSCDGDSGGPLM--------RFRDES 380

  Fly   362 ---AGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
               .|||::|..||..:.||||.:||....||
  Fly   381 WVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/271 (30%)
Tryp_SPc 153..390 CDD:214473 79/269 (29%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 79/274 (29%)
Tryp_SPc 162..415 CDD:238113 81/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.