DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG9737

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:324 Identity:100/324 - (30%)
Similarity:152/324 - (46%) Gaps:58/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ECKNYLDLCCDLPNKR-KDPIFEFKPDHPEGCGYQNPNGVGFKITGAV--NQEAEFGEFPWMLAI 166
            |.:.:||:......|: |..|...:|    ..|:...|..|.::|..:  .:.||..||||:..:
  Fly   107 EYRRFLDVTARFKRKKLKRRIQTVEP----SSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALL 167

  Fly   167 LREEGNLNLYECGGALIAPNVVLTAAHCVHNK----QPSSIVVRAGEWDTQTQTEIRRHEDRYVK 227
            :.   |.|.|.|.||||....:|||||||..:    :.....||.||::.:|:.:. ..|..|:.
  Fly   168 VY---NSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDC-IEEPNYLS 228

  Fly   228 ------EIIY-----HEQFNKGS--LYNDVAVMLLESPFTLQENIQTVCLPN--------VGDKF 271
                  :|.|     |.::.:.|  .|||:|::.|:.|.:....:..:||||        .|..|
  Fly   229 CADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMF 293

  Fly   272 DFDRCYATGWGK----NKFGKDGEYQVILKKVDMPVVPEQQCETNLRE---TRLGRHFILHDSFI 329
            .     .:|||:    ||:..: .:..|..|:.:|.|..:.| |.:.|   .|||      ...|
  Fly   294 S-----VSGWGRTDLFNKYFIN-IHSPIKLKLRIPYVSNENC-TKILEGFGVRLG------PKQI 345

  Fly   330 CAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI-GCGEVNIPGVYASVAKLRPWIDA 392
            |||||..||||.||.|.||:. ...|.:|:.:.|:|::|. .||....|.||.:||:...|||:
  Fly   346 CAGGEFAKDTCAGDSGGPLMY-FDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/270 (32%)
Tryp_SPc 153..390 CDD:214473 86/269 (32%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 86/274 (31%)
Tryp_SPc 150..409 CDD:238113 89/277 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.