DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:117/251 - (46%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHE 222
            |:.|:::.:| ..||.|.: |||::|....|||||||.:.  .|.:.:..|       ..||. :
  Fly    45 GKVPYIVGLL-FSGNGNWW-CGGSIIGNTWVLTAAHCTNG--ASGVTINYG-------ASIRT-Q 97

  Fly   223 DRYVK-----EIIYHEQFNKGSLYNDVAVMLLESP----FTLQENIQTVCLPNVGDKF-DFDRCY 277
            .:|..     :||.|..:|.|:|:||::  |:.:|    ::|...::   ||:..|:: |:...:
  Fly    98 PQYTHWVGSGDIIQHHHYNSGNLHNDIS--LIRTPHVDFWSLVNKVE---LPSYNDRYQDYAGWW 157

  Fly   278 --ATGWGKNKFGKDGEYQVI-----LKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEK 335
              |:|||       |.|...     |:.||:.::.:..|         .|.:.|||:.||...:.
  Fly   158 AVASGWG-------GTYDGSPLPDWLQSVDVQIISQSDC---------SRTWSLHDNMICINTDG 206

  Fly   336 DKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCG-EVNIPGVYASVAKLRPWI 390
            .|.||.||.|.|||   ....||.  .|:.::|...| :...|.|::.|.....||
  Fly   207 GKSTCGGDSGGPLV---THDGNRL--VGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 72/251 (29%)
Tryp_SPc 153..390 CDD:214473 70/249 (28%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.