DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG11842

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:110/270 - (40%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGE 209
            |.....:..:.|.||..|.              |||.||:...|||||||.::.|.|..:.|.|:
  Fly    84 FPHAARLGHKDENGEVEWF--------------CGGTLISDRHVLTAAHCHYSPQGSVNIARLGD 134

  Fly   210 WDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274
            .:..|..:....||..||:...|.:|:..::|||::|:.|..|.|..:.....|||     ||..
  Fly   135 LEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP-----FDDG 194

  Fly   275 RC----YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRL-----------GRHFIL 324
            |.    .|.|||:                 :.:||..: ...|::.:|           .|:..|
  Fly   195 RLGTSFIAIGWGQ-----------------LEIVPRTE-NKKLQKVKLYNYGTRCRITADRNDEL 241

  Fly   325 HDSF-----ICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVA 384
            .:.:     :|.|..:.||||.||.|.|::.........:...||.:.|:.|...::|.:|..|.
  Fly   242 PEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVH 306

  Fly   385 KLRPWIDAKL 394
            ....||..:|
  Fly   307 FYLDWIKQQL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 68/257 (26%)
Tryp_SPc 153..390 CDD:214473 67/256 (26%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/267 (26%)
Tryp_SPc 73..312 CDD:214473 68/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.