DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG11841

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:300 Identity:84/300 - (28%)
Similarity:124/300 - (41%) Gaps:28/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YLDLCCDLPNKRKDPIFE-------FKPDHP------EGCGYQNPNGVGFKITGAVNQEAEFGEF 160
            :..|.|   .|.|..:||       |..|.|      :.|....|    ..:.|.   .||..||
  Fly    29 FAQLAC---TKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP----LIVDGT---PAEPKEF 83

  Fly   161 PWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDR 224
            |:...: .|:..|...:.|||.||:..:|||||||..::.....|||.||.:..|.|:....||.
  Fly    84 PFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDF 148

  Fly   225 YVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKD 289
            .|..:..|..|....||||:.::.|:............||| ..|....:...|.|||:.||.:.
  Fly   149 GVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLP-FDDGEQHESFIAIGWGQKKFAQK 212

  Fly   290 GEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAG 354
            ...:::  ||.:... :.:|.:::.......:.....|.:|.|...:||||.||.|.|::.....
  Fly   213 ESKKLL--KVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKD 274

  Fly   355 QKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKL 394
            ....:...||.:.||.|...:||..|..|.....||..:|
  Fly   275 LACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/238 (29%)
Tryp_SPc 153..390 CDD:214473 69/237 (29%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 71/245 (29%)
Tryp_SPc 72..310 CDD:214473 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.