DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and aqrs

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:229 Identity:52/229 - (22%)
Similarity:87/229 - (37%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGGALIAPNVVLTAAHCVHNKQPSSIV-VRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLY 241
            |.||||:..:|:|:.||...::...|. ..|......|..|:..:.:.: :.|.:....||...:
  Fly    89 CAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPH-QVIGFFMPVNKNERF 152

  Fly   242 NDVAVMLLESPFTLQENIQTVCL----PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMP 302
            .:...:|..|....::..:.:.|    |..||  |....|   :|..||      |:.|....:.
  Fly   153 TNYVALLALSNKLDRDKYRYIPLHRKKPQAGD--DVKMAY---YGPPKF------QIRLYNTRVM 206

  Fly   303 VVPEQQCETNLRETRLGRHFILHDS-----FICAGGEK--DKDTCKGDGGSPLVCPIAGQKNRFK 360
            .:...:....|:|       :.|.|     |||...::  .|.||....|.||:..       .|
  Fly   207 DIDRCKIHYGLKE-------VFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLID-------NK 257

  Fly   361 SAGIVAWGIGCGE----VNIPGVYASVAKLRPWI 390
            .|.|..:|..|.|    .|: .:|..:..:.|:|
  Fly   258 LAAINIYGEHCDEDDDSTNM-DIYLPIRPVIPFI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 52/229 (23%)
Tryp_SPc 153..390 CDD:214473 51/227 (22%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 51/227 (22%)
Tryp_SPc 83..268 CDD:304450 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.