DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG5909

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:409 Identity:107/409 - (26%)
Similarity:183/409 - (44%) Gaps:113/409 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VNPKDSSGSTGSENGGSSSTQYQSC-------GDQKECVPRWLCANDTINTSGDGIIDIRLGTDA 104
            |.|..::|         ...:||.|       |.....:||.:  ::.|             ::.
  Fly    26 VTPAQAAG---------QCIRYQECPFVQKILGIYGRNIPRKI--HNQI-------------SEM 66

  Fly   105 ECKNYLD-----LCCDLPNK---RKDPIFEFKPDHPEG-------------------CGYQ-NPN 141
            :|::..:     |||  ||:   :.:...:.|....||                   ||.: || 
  Fly    67 QCRSTTNTRDFHLCC--PNEAPPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNP- 128

  Fly   142 GVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVR 206
                |::|  .:.|..|:|||:..:..:..:...:.|||:||:...:||||||:.: ||..|.||
  Fly   129 ----KVSG--GKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIID-QPEVIAVR 186

  Fly   207 AGEWDTQTQTE-----------IRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQ 260
            .||.|.:::.:           |..:|:..:::|..|..:..|.:.:|||::.|:.....:.:|:
  Fly   187 LGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHIK 251

  Fly   261 TVCLP--NVGDKFDFDRC-YATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHF 322
            .||||  ....:.|||:. :..|||..      |.:.:..|:...::..:    :|.|.|  :::
  Fly   252 PVCLPIDQKSQELDFDQSFFVAGWGGT------EKETVATKLQQALITRK----SLNECR--QYY 304

  Fly   323 ---ILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSA------GIVAWGIG--CGEVNI 376
               .:.|:.|||.|...|.||:||.|.|:..     |:|||:.      |:|::| |  ||: |.
  Fly   305 NKGEVSDNHICATGTGIKHTCQGDSGGPVFF-----KHRFKNTYRVVQYGVVSFG-GRLCGQ-NQ 362

  Fly   377 PGVYASVAKLRPWIDAKLK 395
            |||:|||..:.|||...|:
  Fly   363 PGVFASVIDMLPWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 80/262 (31%)
Tryp_SPc 153..390 CDD:214473 79/261 (30%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829 14/81 (17%)
Tryp_SPc 129..376 CDD:214473 81/268 (30%)
Tryp_SPc 132..379 CDD:238113 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.