DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and grass

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:359 Identity:88/359 - (24%)
Similarity:154/359 - (42%) Gaps:67/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GDQKECVPRWLCANDTINTSGDGIIDIRL--------GTDAECKNYLD------------LCCDL 116
            |||.:|:|...|..          |:.||        ...|:..:||.            .||..
  Fly    37 GDQGQCMPFSSCRT----------IEERLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCCPS 91

  Fly   117 PN-KRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGG 180
            .| :....:.....|....||    |.:..:::.  ..|.:....|||..:..::...:.:.|||
  Fly    92 ANIQHNSKVMSLFKDENFDCG----NFLSQRVSN--GYEVKLSSRPWMALLRYQQFGESRFLCGG 150

  Fly   181 ALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRY----------VKEIIYHEQF 235
            |:|:...:||||||||..|.....:|.||....|:.:.|:...:.          :::.:.||::
  Fly   151 AMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKY 215

  Fly   236 NKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKF-----DFDRCYATGWGKNKFGKDGEYQVI 295
            :...:.:|:|::.|......|::|:.:||| :.|:.     .....:.||||..:.|...:   :
  Fly   216 DARHIMHDIALLKLNRSVPFQKHIKPICLP-ITDELKEKAEQISTYFVTGWGTTENGSSSD---V 276

  Fly   296 LKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCP---IAGQKN 357
            |.:.::|:.|...|....|..       :..|.:|.||...:|:||||.|.||..|   :.....
  Fly   277 LLQANVPLQPRSACSQAYRRA-------VPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAP 334

  Fly   358 RFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWI 390
            :....|||:.| :.||::::||:|.:|.:...||
  Fly   335 KMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/257 (27%)
Tryp_SPc 153..390 CDD:214473 67/255 (26%)
grassNP_651543.1 CLIP 32..90 CDD:197829 13/62 (21%)
Tryp_SPc 121..371 CDD:238113 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.