DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:299 Identity:92/299 - (30%)
Similarity:137/299 - (45%) Gaps:45/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PNKRKDPIFEFKPDH------PEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNL 175
            |.....|:    |.|      |:.||.:.......:|.|.::  |..||.||..::  :||..:.
Mouse   725 PTAAPSPV----PLHPSTTAKPQECGARPAMDKPTRIVGGIS--AVSGEVPWQASL--KEGPRHF 781

  Fly   176 YECGGALIAPNVVLTAAHCVHNKQPSSI------VVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQ 234
              ||..::....:|:||||.::.:...:      |...|...:..:..:||        :..|.:
Mouse   782 --CGATVVGDRWLLSAAHCFNHTKVEQVQAHLGTVSLLGVGGSPVKLGLRR--------VALHPR 836

  Fly   235 FNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDR-CYATGWGKNKFGKDGEYQVILKK 298
            :|.|.|..|||::.|..|....:.||.||||....||...| |..:|||..:.| :.....||:|
Mouse   837 YNPGILDFDVALLELAQPLVFNKYIQPVCLPLAIHKFPVGRKCMISGWGNMQEG-NATKPDILQK 900

  Fly   299 VDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSA 362
            ..:.::.::.|....       :|.|.|..:|||. |...|:|:||.|.||.|  ......|..|
Mouse   901 ASVGIIEQKMCGALY-------NFSLTDRMLCAGFLEGRVDSCQGDSGGPLAC--EETPGVFYLA 956

  Fly   363 GIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKIWSIDP 401
            |||:|||||.:...|||||.:.:|:.||   ||..|.||
Mouse   957 GIVSWGIGCAQAKKPGVYARITRLKDWI---LKAMSSDP 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 77/245 (31%)
Tryp_SPc 153..390 CDD:214473 76/244 (31%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473 78/251 (31%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.