DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG7142

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:258 Identity:74/258 - (28%)
Similarity:118/258 - (45%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QEAEFGEFPWMLAILREEGNLNL-YECGGALIAPNVVLTAAHCVHNKQ--PSSIVVRAGEWDTQT 214
            :||.....|::::|.....:..| :.|.|.:|..:.:||||||:.:.|  .:|::| ||..|...
  Fly    84 REATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIV-AGSHDIHD 147

  Fly   215 Q----TEIR-RHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274
            |    :.|: ||.|.||:    ||.:..|....|:|::..:.|......:|...||....:   .
  Fly   148 QKGEASNIQMRHIDYYVR----HELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ---P 205

  Fly   275 RCYAT--GWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGG-EKD 336
            ..|.|  |||.........|...|::.:||::..:.||..|..:.|.    ||::.:|.|. ...
  Fly   206 EGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLP----LHETNLCTGPLTGG 266

  Fly   337 KDTCKGDGGSPLV---CPIAGQKNRFKSA----GIVAWG-IGCGEVNIPGVYASVAKLRPWID 391
            ...|..|.|.||:   |     :..|:.|    |||:|| :.||:.|.|.|:..|:....||:
  Fly   267 VSICTADSGGPLIQQCC-----EEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWIN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/256 (29%)
Tryp_SPc 153..390 CDD:214473 72/255 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 74/258 (29%)
Tryp_SPc 84..323 CDD:214473 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.