DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG5255

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:107/269 - (39%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGAVNQEAEFGEFPWMLAILREEG-NLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGE 209
            :|.|  .:||..|..|:.:::   :| ....:.||||:|....::|||||...:|.::..|..|.
  Fly    29 RIVG--GEEAAAGLAPYQISL---QGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGT 88

  Fly   210 WDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274
            .|.........:.||    |:.|..:......||:|::.|..........|.|       :.|.:
  Fly    89 QDLHQNGSKYYYPDR----IVEHSNYAPRKYRNDIALLHLNESIVFDNATQPV-------ELDHE 142

  Fly   275 ------RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDS------ 327
                  |...||||....|  |:....|:.:::..||.:||..            .||:      
  Fly   143 ALVPGSRLLLTGWGTLSLG--GDVPARLQSLEVNYVPFEQCRA------------AHDNSTRVDI 193

  Fly   328 -FICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID 391
             .:|...:|.:..|.||.|.|||       :..|...:|.||:.|.: ..|..:||::....:|.
  Fly   194 GHVCTFNDKGRGACHGDSGGPLV-------HNGKLVALVNWGLPCAK-GYPDAHASISYYHDFIR 250

  Fly   392 AKLKIWSID 400
            ..|.:...|
  Fly   251 THLSLSKTD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 61/251 (24%)
Tryp_SPc 153..390 CDD:214473 61/250 (24%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 63/257 (25%)
Tryp_SPc 30..252 CDD:238113 64/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.