DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG14892

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:418 Identity:93/418 - (22%)
Similarity:136/418 - (32%) Gaps:155/418 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWM--L 164
            |.....::|.|...||:.|     :|:.|    ||.:........|.||...|   |:|||.  |
  Fly    46 TSTATLSWLCLLLLLPSSR-----QFETD----CGCRPARRGPRIIAGAATNE---GQFPWQASL 98

  Fly   165 AILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ-----PSSIVVRAGEWDTQTQTEIRRHEDR 224
            .:|........:.||..||....:|:|||||||..     |....|..||.|...::   .:|.|
  Fly    99 ELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVES---GNEQR 160

  Fly   225 Y-VKEIIYHEQFNKGSLYNDVAVMLLESP--FTLQENIQTVCLP--------------------- 265
            . |::|:.|.:::  :..:||.:|.|..|  .|...||:.:|||                     
  Fly   161 IPVEKIVMHHRYH--NFKHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSA 223

  Fly   266 ------------NVGDKFD---------------------------------------------- 272
                        :|.:|.|                                              
  Fly   224 DEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKR 288

  Fly   273 ------------------------------------FDRCYATGWGKNKFGKDGEYQVILKKVDM 301
                                                |..|.||||||.....|...|::  |..:
  Fly   289 SRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLL--KTQV 351

  Fly   302 PVVPEQQCETNLRETRLGRHFILHDSFICAG---GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAG 363
            |:....:|     ....|....:|...:|||   ||  ..||.||.|.||.|.:: :...:...|
  Fly   352 PLHQNGRC-----RDAYGSFVNIHGGHLCAGKLNGE--GGTCVGDSGGPLQCRLS-RDGPWILVG 408

  Fly   364 IVAWGIGCGEVNIPGVYASVAKLRPWID 391
            :.::|.||.....|.||...:....||:
  Fly   409 VTSFGSGCALEGFPDVYTRTSYYMKWIE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 79/365 (22%)
Tryp_SPc 153..390 CDD:214473 78/364 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 81/372 (22%)
Tryp_SPc 81..438 CDD:238113 83/374 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.