DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG10041

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:256 Identity:60/256 - (23%)
Similarity:107/256 - (41%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAG--EWDTQTQTEIRRHE 222
            :|::::|.........:.|.|.:::...||:||||:.......:.|..|  ..:::.||..    
  Fly    50 YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRF---- 110

  Fly   223 DRYVKEIIYHEQFN-KGSLYNDVAVMLLESPFTLQE-NIQTVCLPNVGDKFDFDRCYATGWGKNK 285
              :|.|..:|.||. .|.  ||:||:.:...|.|.: ..:::.......:....:....|||:..
  Fly   111 --FVVERRWHPQFRVLGG--NDIAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVG 171

  Fly   286 FGKDGEYQVILKKVDMP--VVPEQQCETNLRETRLGRHFILHDSFICAGGEK-DKDTCKGDGGSP 347
            .||      |.|..:||  .:...:|:.:      .|...|....|||...| .:..|.||.|:|
  Fly   172 VGK------IRKLQEMPFLTMENDECQQS------HRFVFLKPLDICAMHLKGPRGPCDGDSGAP 224

  Fly   348 LVCPIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWID-------AKLKIWSID 400
            |: .:|.:    |..|::::| ..|..:. |..:..:.....||.       |:||:..|:
  Fly   225 LM-NVAKE----KLYGLLSYGRKACTPLK-PYAFTRINAYSSWIQESMDSMAARLKVLQIN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 55/238 (23%)
Tryp_SPc 153..390 CDD:214473 54/237 (23%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 56/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.