DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG3916

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:109/257 - (42%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KITGA--VNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK--QPSSIVVR 206
            :|.|.  ||:..     |:.:::..:......:.|||::::...|||||||:...  :..|:||.
  Fly    30 RINGGQRVNETV-----PFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVG 89

  Fly   207 AGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQ-ENIQTVCL---PNV 267
            ...|    :....||  |.|.:.::.:......:.||:|::.:..||.|: .:|.|:.:   ..:
  Fly    90 TLNW----KAGGLRH--RLVTKHVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILIGGSDRI 148

  Fly   268 GDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLR----ETRLGRHFILHDSF 328
            |:|..   ...||||...           .......:|:|....|.|    |....:.|.:..:.
  Fly   149 GEKVP---VRLTGWGSTS-----------PSTSSATLPDQLQALNYRTISNEDCNQKGFRVTRNE 199

  Fly   329 ICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390
            |||...:.:..|.||.|.||:.|  |::...  .|||::|........|.||..|:...|:|
  Fly   200 ICALAVQGQGACVGDSGGPLIRP--GKQPHL--VGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 60/248 (24%)
Tryp_SPc 153..390 CDD:214473 59/246 (24%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 63/255 (25%)
Tryp_SPc 31..260 CDD:238113 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.