DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG13318

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:388 Identity:140/388 - (36%)
Similarity:187/388 - (48%) Gaps:62/388 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCAN--DTI 88
            ::..:......|....|.|.:|:|               .|.|  |    :|||...|||  .|.
  Fly    63 IVGTLLPPQVAPGTWPPVPSIVSP---------------GTSY--C----QCVPPGSCANPLPTA 106

  Fly    89 NTSGDGIIDIRL------------GTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPN 141
            .:.|.|.||||:            .:...|...|..||...:.:              ||.:.|.
  Fly   107 PSDGSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQAGSYQ--------------CGRRFPP 157

  Fly   142 GVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVR 206
            ..|  .|.|...:|.||.:||..|:|.   ..::|..|||||....||||||.|:|...:...||
  Fly   158 PPG--STTAAPGQASFGAYPWQAALLT---TADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVR 217

  Fly   207 AGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTL--QENIQTVCLPNVGD 269
            .||||..:.:|....:|.|:..:..:..||..:|.||||::.|.:|.:|  :..:.|||||..  
  Fly   218 LGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTT-- 280

  Fly   270 KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH-DSFICAGG 333
            .|...||:..|||||.||..|.||.|.::||:|::|...|:..|:.||||..|:|. .|||||||
  Fly   281 SFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGG 345

  Fly   334 EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKI 396
            |..||.|.|||||||||...|.   :...|:|||||||.:..:||||.:|....|||...|.:
  Fly   346 EAGKDACTGDGGSPLVCTSNGV---WYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTLTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 107/240 (45%)
Tryp_SPc 153..390 CDD:214473 106/239 (44%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 108/240 (45%)
Tryp_SPc 169..399 CDD:214473 106/237 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4145
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.