DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Sp7

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:407 Identity:102/407 - (25%)
Similarity:147/407 - (36%) Gaps:127/407 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VICLCIFSCGAQDSSLDKLISDIFKTDETPKPSSPPPPVVNPKDSSGSTGSENGGSSSTQYQSCG 72
            |.|....|.|:|:::                 |:.|||......|.|..|....|:.        
  Fly    82 VCCTSDRSFGSQEAT-----------------SAAPPPTTTSSSSRGQDGQAGLGNL-------- 121

  Fly    73 DQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGY 137
                                                       ||:             |..|| 
  Fly   122 -------------------------------------------LPS-------------PPKCG- 129

  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYE--CGGALIAPNVVLTAAHCVHNKQP 200
              |:....|:..  ..:....||.|| |:|....|....|  |||:||....||||||||.....
  Fly   130 --PHSFSNKVYN--GNDTAIDEFNWM-ALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVE 189

  Fly   201 SSI----VVRAGEWDTQTQTEIRRHED--------RYVKEIIYHEQF---NKGSLYNDVAVMLLE 250
            :.:    .||.||:||....:.  .:|        ..:::...|.|:   ||..:: |:|::.|:
  Fly   190 TEVGHLTTVRLGEYDTSKDVDC--IDDICNQPILQLGIEQATVHPQYDPANKNRIH-DIALLRLD 251

  Fly   251 SPFTLQENIQTVCLPNVGDKFDF---DRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETN 312
            .|..|.|.||.||||.|..:...   :....:|||:....:.   ..|.:::|:||.....|...
  Fly   252 RPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARK---STIKQRLDLPVNDHDYCARK 313

  Fly   313 LRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSA----GIVAWGIGCGE 373
            ...    |:..|..|.:|.|||..:|:|.||.|.||:      :..|..|    |:|::|..||.
  Fly   314 FAT----RNIHLISSQLCVGGEFYRDSCDGDSGGPLM------RRGFDQAWYQEGVVSFGNRCGL 368

  Fly   374 VNIPGVYASVAKLRPWI 390
            ...||||..||....||
  Fly   369 EGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 82/262 (31%)
Tryp_SPc 153..390 CDD:214473 80/260 (31%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 1/1 (100%)
Tryp_SPc 136..385 CDD:214473 81/267 (30%)
Tryp_SPc 137..388 CDD:238113 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.