DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and MP1

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:331 Identity:94/331 - (28%)
Similarity:136/331 - (41%) Gaps:55/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CKNYLDLCCDLPNKRK---------DPIFEFKPDHPEG---------CGYQNPNGVGFKITGAVN 152
            |...:.:||.....|.         .|....||....|         ||    ...|.::.|  .
  Fly    83 CFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCG----ENFGDRVVG--G 141

  Fly   153 QEAEFGEFPWMLAI-LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSS---IVVRAGEWDTQ 213
            .|....|||||..| ..:.||:..:.|||:||....|||||||| :..||.   ..||.||||..
  Fly   142 NETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV-SAIPSDWELTGVRLGEWDAS 205

  Fly   214 TQTEI------RR-----HEDRYVKEIIYHEQF--NKGSLYNDVAVMLLESPFTLQENIQTVCLP 265
            |..:.      ||     :.|..|:|.|.|.|:  |.....||:|::.|.......:.|..||||
  Fly   206 TNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLP 270

  Fly   266 NVGDK----FDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHD 326
            .:..:    |...:....|||:.:.......::   |.::..||..:|.......|.    .:..
  Fly   271 TLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL---KAELDTVPTSECNQRYATQRR----TVTT 328

  Fly   327 SFICAGGEKDKDTCKGDGGSPLVC-PIAGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPW 389
            ..:||||.:..|:|:||.|.||:. ..:...:.:..||:|::| ..||....||||..|.....|
  Fly   329 KQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNW 393

  Fly   390 IDAKLK 395
            |:..::
  Fly   394 IENNVR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/260 (31%)
Tryp_SPc 153..390 CDD:214473 80/259 (31%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 1/7 (14%)
Tryp_SPc 137..394 CDD:214473 81/266 (30%)
Tryp_SPc 138..397 CDD:238113 83/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.