DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and Sems

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:253 Identity:80/253 - (31%)
Similarity:116/253 - (45%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWD 211
            |.|.|...|:.|.:   |..:|   ..|.:.|||.||...:|||||||..::.........|...
  Fly    45 IGGRVTTNAKLGGY---LVAMR---YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGIS 103

  Fly   212 TQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNV----GDKFD 272
            ..::..|||...|::|.    .||...::..||||:||..|. :.:||.|:.|.:.    |...|
  Fly   104 RLSEKGIRRQVKRFIKS----AQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMD 163

  Fly   273 FDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDK 337
                 .:|||......:|... :|:.|.:||:.::.|....||:     ..:.||..||.....|
  Fly   164 -----VSGWGMTNPDDEGPGH-MLRTVSVPVIEKRICREAYRES-----VSISDSMFCASVLGKK 217

  Fly   338 DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLK 395
            |.|..|.|.|||.    :|   :..|||::||||.....||||..|..::|:|...:|
  Fly   218 DACTYDSGGPLVY----EK---QVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGIK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/241 (31%)
Tryp_SPc 153..390 CDD:214473 75/240 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 78/246 (32%)
Tryp_SPc 44..265 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.