DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG6865

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:282 Identity:75/282 - (26%)
Similarity:127/282 - (45%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN-- 197
            |..:||..||       ..|||..|.|:|::::|..|:.    |||.:|:...:|||.||:.|  
  Fly    28 CSVRNPKIVG-------GSEAERNEMPYMVSLMRRGGHF----CGGTIISERWILTAGHCICNGL 81

  Fly   198 ---KQPSSIVVRAGEWDTQTQTEIRRHEDR-YV--------------KEIIYHEQFNKGSLYNDV 244
               .:|:           |.|..:..|..| |:              |.|:.|.|::...:.:|:
  Fly    82 QQFMKPA-----------QIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDI 135

  Fly   245 AVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYAT--GWG---KNKFGKDGEYQVILKKVDMPVV 304
            |::.|..|.....:||..|:.:.......::.|.|  |||   :|:  .:.:...:|:|..:.:.
  Fly   136 ALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQ--AENDRSDVLRKATVKIW 198

  Fly   305 PEQQCETNLRETRLGRHFILHDSFICAGGEKDK-DTCKGDGGSPLVCPIAGQKNRFKSAGIVAWG 368
            ..:.||.:.|.  ||:...:.::.:|||.|..: |:|..|.|.||:      .......|:|:.|
  Fly   199 NNEACERSYRS--LGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SKEHHLVGVVSTG 255

  Fly   369 IGCGEVNIPGVYASVAKLRPWI 390
            |||....:||:|..|:|...|:
  Fly   256 IGCARPGLPGIYTRVSKYVSWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 70/264 (27%)
Tryp_SPc 153..390 CDD:214473 69/262 (26%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 71/273 (26%)
Tryp_SPc 35..280 CDD:238113 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.