DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG7542

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:117/247 - (47%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTE 217
            :.||.|:||:...:....||.:.: |||.||:...::|||||:...:  |:.|..|..:...::|
  Fly    31 EPAEVGQFPYQAGLNVSFGNWSTW-CGGTLISHYWIITAAHCMDGAE--SVTVYLGAINIGDESE 92

  Fly   218 IRRHEDRYVKE---IIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLP-NVGDKF---DFDR 275
              ..::|.:.|   ||.|..:...::.||::::.|.:.....:.|:...|| .:..:|   :..|
  Fly    93 --EGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIR 155

  Fly   276 CYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTC 340
            .:|:|||:.....| ....:|:.|:||::|...|       |:.....:.:..||......|.||
  Fly   156 AFASGWGRESDASD-SVSPVLRYVEMPIMPHSLC-------RMYWSGAVSEKMICMSTTSGKSTC 212

  Fly   341 KGDGGSPLVCPIAGQKNRFKSAGIVAWG--IGCGEVNIPGVYASVAKLRPWI 390
            .||.|.|||..   |.|.....|..::|  :|| :|..|.|:..::....||
  Fly   213 HGDSGGPLVYK---QGNSSYLIGSTSFGTSMGC-QVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 68/247 (28%)
Tryp_SPc 153..390 CDD:214473 66/245 (27%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 68/247 (28%)
Tryp_SPc 27..260 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.