DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG4998

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:284 Identity:121/284 - (42%)
Similarity:175/284 - (61%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGA--VNQEAEFGEFPWMLAILREEGNL 173
            ::||..|.:.:.|     |.....||.:|..|:..:|...  |:.::||||:||.:|||:::...
  Fly   902 EVCCRRPLRPQAP-----PQQFGRCGVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKE 961

  Fly   174 NLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKG 238
            ::|.|||.||....:::||||:.::....:.||.||||.....|...:.:|.|..:..|.::..|
  Fly   962 SIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAG 1026

  Fly   239 SLYNDVAVMLLESP--FTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDM 301
            :|.||:||:.|:.|  ||...:|...|||:....|...||:.|||||:.||:.|:||.|||:||:
  Fly  1027 TLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDV 1091

  Fly   302 PVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVA 366
            |::..||||:.||.||||..:.|:..|:|||||:.||.||||||.||||...|..:   ..|:|:
  Fly  1092 PILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNGAMH---VVGVVS 1153

  Fly   367 WGIGCGEVNIPGVYASVAKLRPWI 390
            ||||||:||:||||..|:...|||
  Fly  1154 WGIGCGQVNVPGVYVKVSAYLPWI 1177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 110/240 (46%)
Tryp_SPc 153..390 CDD:214473 108/238 (45%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 110/239 (46%)
Tryp_SPc 942..1177 CDD:214473 108/237 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.