DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG10469

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:62/253 - (24%)
Similarity:120/253 - (47%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 AEFGEFPWMLAIL------REEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS--SIVVRAGEWD 211
            |:..:.|:.:.:|      ::|.|:    |||.:::...::|||||:.:.:.:  .:::..|   
  Fly    30 AKAKQLPYQVGLLCYFEGSKDEPNM----CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG--- 87

  Fly   212 TQTQTEIRRHEDRYVKEI-------IYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGD 269
                 :::..:|   |||       |.|::|::.::.||:|::.|....|..:.||...||:...
  Fly    88 -----KVKSFDD---KEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKK 144

  Fly   270 KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGR-HFILHDSFICAGG 333
            .:...:...:|||...  |....|| |:.:..|::..::||....:...|: ..::|:.|||...
  Fly   145 TYTGRKAIISGWGLTT--KQLPSQV-LQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS 206

  Fly   334 EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI-GCGEVNIPGVYASVAKLRPWI 390
            :|.. .|:||.|.|:|.....:    ...|||:.|. |..::.:|.|...|:....||
  Fly   207 KKGL-PCRGDSGGPMVLDDGSR----TLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 62/253 (25%)
Tryp_SPc 153..390 CDD:214473 60/251 (24%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 60/251 (24%)
Tryp_SPc 24..260 CDD:238113 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.