DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG6462

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:118/290 - (40%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GYQNPNGVGFKI-----------TGAVNQEAEFGE------FPWMLAILREEGNLNLYECGGALI 183
            ||:|     |::           |.||......||      ||:.:.::.:....:|.:|||:||
  Fly    52 GYEN-----FRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLI 111

  Fly   184 APNVVLTAAHCVHNKQPSSI----VVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDV 244
            ....|||||||:.:...:.|    .|.|...|:..:.:: .|.|    .|||.:....|. |:|:
  Fly   112 TLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQV-THRD----FIIYPDYLGFGG-YSDL 170

  Fly   245 AVMLLESPFTLQENIQTVCLPN--------VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDM 301
            |::.|.......|.:|.:.|..        ||.....     :|||......|...: :|:.:|.
  Fly   171 ALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTL-----SGWGYLGDSTDKRTR-LLQYLDA 229

  Fly   302 PVVPEQQC----ETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSA 362
            .|:.:::|    ...|...|  ||       :|..|...:..|.||.|.|:|   ...:|.....
  Fly   230 EVIDQERCICYFLPGLVSQR--RH-------LCTDGSNGRGACNGDSGGPVV---YHWRNVSYLI 282

  Fly   363 GIVAWGI--GCGEVNIPGVYASVAKLRPWI 390
            |:.::|.  || ||..|.||..:....|||
  Fly   283 GVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/262 (26%)
Tryp_SPc 153..390 CDD:214473 67/260 (26%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 67/259 (26%)
Tryp_SPc 77..314 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.