DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG14990

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:266 Identity:119/266 - (44%)
Similarity:160/266 - (60%) Gaps:12/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KPDHPEGCGYQNPNGVGFKITGAVNQEAEF---GEFPWMLAILREEGNLNLYECGGALIAPNVVL 189
            :||..:.||..||||    :...|....::   |:|||::|:..:    ..|...|:||||.|||
  Fly    41 QPDPNQVCGMSNPNG----LVANVKVPKDYSTPGQFPWVVALFSQ----GKYFGAGSLIAPEVVL 97

  Fly   190 TAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFT 254
            |||..|..|..:.||||||||:|..::|....|||.|..::.|.:|:.....|::|::.|.:||.
  Fly    98 TAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFE 162

  Fly   255 LQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLG 319
            |:.:|:|:|||:.|..||..||..|||||..| .|..|..|.||:::|::...||:..||.||||
  Fly   163 LKSHIRTICLPSQGRSFDQKRCLVTGWGKVAF-NDENYSNIQKKIELPMINRAQCQDQLRNTRLG 226

  Fly   320 RHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVA 384
            ..|.|..|.||||||||...|.|||||.|.||:....:|::.||||.|||||.|.|:|.||.:|.
  Fly   227 VSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVE 291

  Fly   385 KLRPWI 390
            ..|.||
  Fly   292 MFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 110/241 (46%)
Tryp_SPc 153..390 CDD:214473 108/239 (45%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 110/236 (47%)
Tryp_SPc 67..297 CDD:214473 108/234 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.