DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5390 and CG9294

DIOPT Version :9

Sequence 1:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:268 Identity:93/268 - (34%)
Similarity:130/268 - (48%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199
            ||..|   ..:||.|  .||....::|||..||    ..|.:.|.|:||....||||||||....
  Fly    92 CGLIN---TLYKIVG--GQETRVHQYPWMAVIL----IYNRFYCSGSLINDLYVLTAAHCVEGVP 147

  Fly   200 PSSIVVRAGEWDTQTQTEIRRHED------RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258
            |..|.:|..|.:       |.|.:      |||..:..||.:|..|..||:||:.|..|..::.:
  Fly   148 PELITLRFLEHN-------RSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205

  Fly   259 -IQTVCLPNVGDKFDFDRCYATGWGKNK---FGKDGEYQVILKKVDMPVVPEQQCETNLRETRLG 319
             ::.:|||.....||.:.....|||..:   ||.|     .|::||:.|:|:.:|. |....|.|
  Fly   206 RLRPICLPVQSYSFDHELGIVAGWGAQREGGFGTD-----TLREVDVVVLPQSECR-NGTTYRPG 264

  Fly   320 RHFILHDSFICAG--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYAS 382
            :   :.|:.:|||  .|..||.|.||.|.||......|..:::.||||:||:||.....||||..
  Fly   265 Q---ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTR 326

  Fly   383 VAKLRPWI 390
            |.:...|:
  Fly   327 VNQYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/250 (35%)
Tryp_SPc 153..390 CDD:214473 86/248 (35%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/254 (35%)
Tryp_SPc 101..334 CDD:238113 88/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.